| Catalog Number:??10117 |
| Product Name:??Rab5 Protein Q79L mutant |
| Synonyms:??Member RAS oncogene family, RAB5A |
| Source: ??Human, recombinant full length, His6-tag |
| Expression Host: ??E. coli |
| Molecular Weight: ??17 kDa |
| Purity: ??>96% by SDS-PAGE |
| Introduction: ??Rab5, consists of three isoforms, Rab5A, Rab5B, and Rab5C, is a small GTPase that is localized to early endosomes. It regulates the fusion between endocytic vesicles and early endosomes, as well as the homotypic fusion between early endosomes. |
| Amino Acid Sequence ???(16-184, Q79L) |
NKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGLERY?
HSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQ?
SYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKN |
Properties
|
| Physical Appearance (form): ??Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
| Physical Appearance (form):??White or clear |
| Concentration:?1 mg/mL |
| Storage:???-80°C |
Preparation Instructions:??
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Rab5 Q79L was determined by SDS-PAGE and Coomassie Brilliant Blue Staining. |
 |
References:??
1. Bucci, C. et al., Cell 70: 715-728, 1992.?
2. Kinchen, J. M. et al., Nature 464: 778-782, 2010.?
3. Kitano, M. et al., Nature 453: 241-245, 2008.?
4. Lanzetti, L. et al., Nature 429: 309-314, 2004.?
5. Lanzetti, L. et al., Nature 408: 374-377, 2000.?
6. Miaczynska, M. et al., Cell 116: 445-456, 2004.?
7. Ohya, T. et al., Nature 459: 1091-1097, 2009.?
8. Otomo, A. et al., Hum. Molec. Genet. 12: 1671-1687, 2003.?
9. Rousseau-Merck, M. F. et al., Hum. Genet. 86: 350-354, 1991.?
10. Stenmark, H. et al., Cell 83: 423-432, 1995.?
11. Xiao, G.-H. et al., J. Biol. Chem. 272: 6097-6100, 1997.?
12. Zahraoui, A. et al., J. Biol. Chem. 264: 12394-12401, 1989. |
| Datasheet:?? |
|
