| Catalog Number:??10138 |
| Product Name:??Gα13 Protein |
| Synonyms:??Guanine nucleotide-binding protein subunit alpha-13 , Galpha 13, G13 |
| Source: ???Human, recombinant full length, His6-tag |
| Expression Host: ??sf9 cells |
| Molecular Weight: ??44 kDa |
| Purity: ??>95% by SDS-PAGE |
| Introduction: ??Ga13 belongs to the G12 family of heterotrimeric guanine nucleotide-binding proteins, and has intrinsic GTPase activity. Ga13 has been revealed to play critical roles in transformation, normal hemostasis and thrombosis, growth factor-induced cell migration, angiogenesis, and salt-induced hypertension. |
| Amino Acid Sequence ??(1-377) |
MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESGKSTFLKQ?
MRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQ?
GMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDNLDKLGEPDYIPSQQDILLARRPTK?
GIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQVLMEDRLTNRLTESLNIFET IVNNRVFSNVSIILFLNKTDLLEEKVQIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYH HFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ |
Properties
|
| Physical Appearance (form): ??Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
| Physical Appearance (form):??White or clear |
| Concentration:?1 mg/mL |
| Storage:???-80°C |
Preparation Instructions:???
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Gα13 was determined by SDS- PAGE and Coomassie Brilliant Blue Staining. |
 |
References:???
1. Gong, H. et al., Science 327: 340-343, 2010.?
2. Kabouridis, P. S. et al., Molec. Cell. Biochem. 144: 45-51, 1995. 3. Kilts, J. D. et al., J. Cardiovasc. Pharm. 50: 299-303, 2007.?
4. Moers, A. et al., Nature Med. 9: 1418-1422, 2003. 5. Offermanns, S. et al, Science 275: 533-536, 1997. 6. Radhika, V. et al., J. Biol. Chem. 279: 49406-49413, 2004.?
7. Ruppel, K. M. et al., Proc. Nat. Acad. Sci. 102: 8281-8286, 2005. 8. Shan, D. et al., Dev. Cell 10: 707-718, 2006.?
9. Wirth, A. et al., Nature Med. 14: 64-68, 2008. |
| Datasheet:?? |
