| Catalog Number:??10152 |
| Product Name:??Arl3 Protein |
| Synonyms:??ADP-ribosylation factor-like 3, ARFL3 |
| Source: ??Human, recombinant full length, His6-tag |
| Expression Host: ??E. coli |
| Molecular Weight: ??20 kDa |
| Purity: ??>95% by SDS-PAGE |
| Introduction: ??Arl3 belongs to the member of the Arf family of regulatory GTPases, within the Ras superfamily of GTPases. Arl3 is also a member of the ADP-ribosylation factor family of GTP-binding proteins. Arl3 binds guanine nucleotides but lacks ADP-ribosylation factor activity. |
| Amino Acid Sequence ??(1-182) |
MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWD?
IGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAA?
PASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK |
Properties
|
| Physical Appearance (form): ??Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
| Physical Appearance (form):??White or clear |
| Concentration:??1 mg/mL |
| Storage:???-80°C |
Preparation Instructions:??
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Arl3 was determined by SDS- PAGE and Coomassie Brilliant Blue Staining. |
 |
References:??
1. Cavenagh, M. M. et al., J. Biol. Chem. 269: 18937-18942, 1994.?
2. Grayson, C. et al., Hum. Molec. Genet. 11: 3065-3074, 2002.?
3. Kim, H.-S. Cytogenet. Cell Genet. 83: 246-only, 1998.?
4. Schrick, J. JAm. J. Path. 168: 1288-1298, 2006.?
5. Veltel, S. et al., Nature Struct. Molec. Biol. 15: 373-380, 2008. |
