| Catalog Number:??10157 |
| Product Name:??CST3 Protein |
| Synonyms:??Cystatin C, Cystatin 3, CYSC |
| Source: ???Human, recombinant full length, His6-tag |
| Expression Host: ???E. coli |
| Molecular Weight: ??16 kDa |
| Purity: ??>95% by SDS-PAGE |
| Introduction: ??Cystatin C, which belongs to the type 2 cystatin gene family, is a potent inhibitor of lysosomal proteinases. It regulates the activity of cathepsin S, a protease with central regulatory functions in retinal pigment epithelial (RPE) cells. |
| Amino Acid Sequence ??(1-146) |
MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDM?
YHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQG?
TMTLSKSTCQDA |
Properties
|
| Physical Appearance (form): ??Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
| Physical Appearance (form):??White or clear |
| Concentration:??1 mg/mL |
| Storage:???-80°C |
Preparation Instructions:??
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged CST3 was determined by SDS- PAGE and Coomassie Brilliant Blue Staining. |
 |
References:??
1. Paraoan, L. et al., Traffic 5: 884-895, 2004.?
2. Ratnayaka, A. et al., Exp. Eye Res. 84: 1135-1139, 2007.?
3. Zurdel, J. et al., Brit. J. Ophthal. 86: 214-219, 2002. |
