| Catalog Number:??10123 |
| Product Name:??Arf1 Protein Δ17 Q71L mutant |
| Synonyms:??ADP-ribosylation factor 1 |
| Source: ??Human recombinant, His6-tag |
| Expression Host: ??E. coli |
| Molecular Weight: ??21 kDa |
| Purity: ??>95% by SDS-PAGE |
| Introduction: ??Arf1 is a member of the ARF super-family. ARF genes encode small GTPases that increase the ADP-ribosyltransferase activity of cholera toxin and are critical for vesicular trafficking as activators of phospholipase D. Arf1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. |
| Amino Acid Sequence ??(1-181, Δ17, Q71L) |
MGNIFANLFKGLFGKK-MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWD?
VGGLDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAM?
NAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK |
Properties
|
| Physical Appearance (form): ??Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
| Physical Appearance (form):??White or clear |
| Concentration:??1 mg/mL |
| Storage:???-80°C |
Preparation Instructions:??
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside(DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Arf1 Δ17 Q71L was determined by SDS-PAGE and Coomassie Brilliant Blue Staining |
 |
References:??
1. Amor, J. C. et al., Nature 372: 704-708, 1994.?
2. Bobak, D. A. et al., Proc. Nat. Acad. Sci. 86: 6101-6105, 1989.?
3. Hirai, M. et al., Genomics 34: 263-265, 1996.?
4. Kumari, S. et al., Cell Biol. 10: 30-41, 2008.?
5. Lee, C.-M. et al., J. Biol. Chem. 267: 9028-9034, 1992.?
6. Mossessova, E. et al., Cell 92: 415-423, 1998.?
7. Peng, Z. G. et al., Biofactors 2: 45-49, 1989.?
8. Presley, J. F. et al., Nature 417: 187-193, 2002.?
9. Renault, L. et al., Nature 426: 525-530, 2003. |
|
