| Catalog Number:??10169 |
| Product Name:??RalB Protein |
| Synonyms:??v-ral simian leukemia viral oncogene homolog B |
| Source: ??Human, recombinant full length, His6-tag |
| Expression Host: ??E. coli |
| Molecular Weight: ???23 kDa |
| Purity: ???>95% by SDS-PAGE |
| Introduction: ??The Ras-like small G proteins, RalA/B, are important components of Ras signaling pathways, implicated in the initiation and maintenance of tumorigenic transformation, as well as vesicle transport, apoptosis, transcription, cell migration, and cell proliferation. |
| Amino Acid Sequence ??(1-206) |
MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDIL?
DTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEE?
RRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL |
Properties
|
| Physical Appearance (form): ??Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
| Physical Appearance (form):??White or clear |
| Concentration:??1 mg/mL |
| Storage:???-80°C |
Preparation Instructions:??
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged RalB was determined by SDS- PAGE and Coomassie Brilliant Blue Staining. |
 |
References:??
1. Chien, Y. et al., Cell 127: 157-170, 2006.?
2. Hsieh, C.-L. et al., Somat. Cell Molec. Genet. 16: 407-410, 1990 |
