| Catalog Number:??10114 |
| Product Name:??Sar1a Protein |
| Synonyms:??SAR1 homolog A, SAR1, Sara, SARA1, Masra2 |
| Source: ??Human, recombinant full length, His6-tag |
| Expression Host: ???E. coli |
| Molecular Weight: ??22 kDa |
| Purity: ??>95% by SDS-PAGE |
| Introduction: ??Small GTPases are a super-family of cellular signaling regulators. Sar1 is a member of these small GTPases. Sar1 functions as a molecular switch to control protein–protein and protein–lipid interactions that direct vesicle budding from the ER. |
| Amino Acid Sequence ??(1-198) |
MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIA?
GMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGN?
KIDRTDAISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID |
Properties
|
| Physical Appearance (form): ??Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
| Physical Appearance (form):??White or clear |
| Concentration: ??1 mg/mL |
| Storage:???-80°C |
Preparation Instructions:??
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Sar1a was determined by SDS- PAGE and Coomassie Brilliant Blue Staining. |
 |
References:??
1. He, H. et al., Gene Expr. 10: 231-242, 2002.?
2. Jones, B. et al., Nature Genet. 34: 29-31, 2003.?
3. South, S. T. et al., J. Cell Biol. 149: 1345-1359, 2000. |
| ? |
