| Catalog Number:??10101 |
| Product Name:??Rac1 Protein |
| Synonyms:??Ras-related C3 botulinum toxin substrate 1, Rac-1, p21-Rac1, MIG5, TC-25 |
| Source: ???Human, recombinant full length, His6-tag |
| Expression Host: ??E. coli |
| Molecular Weight: ??21 kDa |
| Purity: ???>95% by SDS-PAGE |
| Introduction: ??Small GTPases are a super-family of cellular signaling regulators. Rac belongs to the Rho sub-family of GTPases that regulate cell motility, cell division, and gene transcription. GTP binding increases the activity of Rac, and the hydrolysis of GTP to GDP renders it inactive. GTP hydrolysis is aided by GTPase activating proteins (GAPs), while exchange of GDP for GTP is facilitated by guanine nucleotide exchange factors (GEFs). |
| Amino Acid Sequence ??(1-192) |
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRL?
RPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKL?
TPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
Properties
|
| Physical Appearance (form): ??Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
| Physical Appearance (form):??White or clear |
| Concentration:??1 mg/mL |
| Storage:???-80°C |
Preparation Instructions:??
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Rac1 was determined by SDS- PAGE and Coomassie Brilliant Blue Staining. |
 |
References:??
1. Aznar Benitah, S. et al., Science 309: 933-935, 2005.?
2. Chuang, Y. et al., Cancer Res. 64: 8271-8275, 2004.?
3. Halet, G. et al., Dev. Cell 12: 309-317, 2007.?
4. Machacek, M. et al., Nature 461: 99-103, 2009. 5. Matos, P. et al., Biochem. Biophys. Res. Commun. 277: 741-751, 2000.?
6. Moore, K. A. et al., Biochem. J. 326: 17-20, 1997. 7. Walmsley, M. J. et al., Science 302: 459-462, 2003.?
8. Wu, Y. I. et al., Nature 461: 104-108, 2009. |
| Datasheet:?? |
